PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA12G00046
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 245aa    MW: 26815.6 Da    PI: 5.9053
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA12G00046genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.98.2e-1789141355
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                 +lkr rr+ +NRe+A+rsR++K++ +++Le  v++L++eN++L k+l   ++e
  AA12G00046  89 DLKRIRRMFSNRESAKRSRKKKQEHLAKLESQVDSLKGENSTLYKQLIDATQE 141
                 79*****************************************9988666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.8E-1482143No hitNo description
SMARTSM003382.2E-1587151IPR004827Basic-leucine zipper domain
PfamPF001702.9E-1489136IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.97889141IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.94E-1290141No hitNo description
CDDcd147023.81E-1992143No hitNo description
PROSITE patternPS00036094109IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MQDYSCELKD SLLWTESLIS SGPFLDSIID AQSSICENLS ADSPVSANKP EARRGVRRTT  60
SGSSSHEHSD EEDAETEAGQ SEMTNDPNDL KRIRRMFSNR ESAKRSRKKK QEHLAKLESQ  120
VDSLKGENST LYKQLIDATQ EFRSAGTNNR VLKSDVETLR VKVKLAEDLV ARGSLTSSLN  180
QLLQTHLSPP QHINNLHYAG TTSPTITGHS DQSLFPGITL SGQNSSPGLG TVSSEAVSCV  240
SDIWP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568457.11e-146basic leucine zipper 9
SwissprotQ9FUD31e-148BZIP9_ARATH; Basic leucine zipper 9
TrEMBLD7M3891e-141D7M389_ARALL; Putative uncharacterized protein
STRINGAT5G24800.11e-145(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-116basic leucine zipper 9